PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G22950.1
Common NameAGL19, F7H19.130, GL19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25048.5 Da    PI: 9.9624
Description AGAMOUS-like 19
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G22950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien + rqvtfskRrng+lKKA+ELSvLCdaeva++ifs++ klye+ss
  AT4G22950.1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSS 59
                 79***********************************************96 PP

2K-box79.48.8e-2779170798
        K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  +++ + ++++ + e + L k+ie+L+ ++R+llGe+++ +s++eLqqLe+qL++sl++iR+kK++ll+e+ie+l+  e++l +enk+L++k+
  AT4G22950.1  79 NHKRNDNSQQARDETSGLTKKIEQLEISKRKLLGEGIDACSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEKW 170
                  4467788999*******************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.286161IPR002100Transcription factor, MADS-box
CDDcd002651.85E-39370No hitNo description
PRINTSPR004044.4E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-31374IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-303859IPR002100Transcription factor, MADS-box
PfamPF014863.7E-2683169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.84586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0006036anatomyroot epidermis
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020038anatomypetiole
PO:0020131anatomylateral root cap
PO:0025022anatomycollective leaf structure
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007131developmental stageseedling development stage
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVIFSP RSKLYEFSSS  60
SIAATIERYQ RRIKEIGNNH KRNDNSQQAR DETSGLTKKI EQLEISKRKL LGEGIDACSI  120
EELQQLENQL DRSLSRIRAK KYQLLREEIE KLKAEERNLV KENKDLKEKW LGMGTATIAS  180
SQSTLSSSEV NIDDNMEVET GLFIGPPETR QSKKFPPQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-17369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_D4e-17369268Myocyte-specific enhancer factor 2A
3mu6_C4e-17369268Myocyte-specific enhancer factor 2A
3mu6_B4e-17369268Myocyte-specific enhancer factor 2A
3mu6_A4e-17369268Myocyte-specific enhancer factor 2A
3p57_J4e-17369268Myocyte-specific enhancer factor 2A
3p57_I4e-17369268Myocyte-specific enhancer factor 2A
3p57_D4e-17369268Myocyte-specific enhancer factor 2A
3p57_C4e-17369268Myocyte-specific enhancer factor 2A
3p57_B4e-17369268Myocyte-specific enhancer factor 2A
3p57_A4e-17369268Myocyte-specific enhancer factor 2A
3kov_J4e-17369268Myocyte-specific enhancer factor 2A
3kov_I4e-17369268Myocyte-specific enhancer factor 2A
3kov_B4e-17369268Myocyte-specific enhancer factor 2A
3kov_A4e-17369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254286_at0.0
Expression AtlasAT4G22950-
AtGenExpressAT4G22950-
ATTED-IIAT4G22950-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}.
Functional Description ? help Back to Top
Source Description
TAIRMADS-box protein AGL19
UniProtProbable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}.
Function -- GeneRIF ? help Back to Top
  1. AGL19 expression is maintained at very low levels by the PcG proteins MSI1, CLF, and EMF2, and AGL19 is partly responsible for the early flowering phenotype of clf mutants.
    [PMID: 16778081]
  2. The data indicate thatHDA9 represses flowering by repressing AGL19 gene expressionindependently of CONSTANS or FLC pathways.
    [PMID: 23237803]
  3. HDA9 prevents precocious flowering under SD conditions by curbing the hyperactivation of AGL19, an upstream activator of FT, through resetting the local chromatin environment.
    [PMID: 25406502]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G22950.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G37940
IntActSearch O82743
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Decreased response to vernalization, the promotion of flowering by prolonged cold. {ECO:0000269|PubMed:16778081}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G22950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3126640.0AF312664.1 Arabidopsis thaliana MADS-box protein AGL19 (AGL19) mRNA, complete cds.
GenBankAY1425230.0AY142523.1 Arabidopsis thaliana putative MADS box AGL protein (At4g22950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194026.11e-159agamous-like MADS-box protein AGL19
SwissprotO827431e-161AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLD7MDY61e-140D7MDY6_ARALL; Putative uncharacterized protein
STRINGAT4G22950.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes.
    Plant J., 2000. 24(4): p. 457-66
    [PMID:11115127]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  7. De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D
    Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.
    Plant J., 2004. 39(4): p. 537-59
    [PMID:15272873]
  8. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  9. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  10. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  11. Schönrock N, et al.
    Polycomb-group proteins repress the floral activator AGL19 in the FLC-independent vernalization pathway.
    Genes Dev., 2006. 20(12): p. 1667-78
    [PMID:16778081]
  12. Pien S, et al.
    ARABIDOPSIS TRITHORAX1 dynamically regulates FLOWERING LOCUS C activation via histone 3 lysine 4 trimethylation.
    Plant Cell, 2008. 20(3): p. 580-8
    [PMID:18375656]
  13. Alexandre CM,Hennig L
    FLC or not FLC: the other side of vernalization.
    J. Exp. Bot., 2008. 59(6): p. 1127-35
    [PMID:18390846]
  14. Liang S, et al.
    Transcriptional Regulations on the Low-Temperature-Induced Floral Transition in an Orchidaceae Species, Dendrobium nobile: An Expressed Sequence Tags Analysis.
    Comp. Funct. Genomics, 2012. 2012: p. 757801
    [PMID:22550428]
  15. Kim W,Latrasse D,Servet C,Zhou DX
    Arabidopsis histone deacetylase HDA9 regulates flowering time through repression of AGL19.
    Biochem. Biophys. Res. Commun., 2013. 432(2): p. 394-8
    [PMID:23237803]
  16. Kang MJ,Jin HS,Noh YS,Noh B
    Repression of flowering under a noninductive photoperiod by the HDA9-AGL19-FT module in Arabidopsis.
    New Phytol., 2015. 206(1): p. 281-94
    [PMID:25406502]